Bacterial taxon 1392858
Locus CO715_11885
Protein ATI06345.1
DedA family protein
Escherichia coli M12
Length 219 aa, Gene n/a, UniProt n/a
>ATI06345.1|Escherichia coli M12|DedA family protein
MAVIQDIIAALWQHDFAALADPHIVSVVYFVMFATLFLENGLLPASFLPGDSLLILAGALIAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLAQLPAKYHQRATCMFDRHGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLLWVSVVTSFGYALSMIPFVKRHEDQVMTFLMILPIALLTAGLLGTLFVVIKKKYCNA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.52 | 1.6e-5 | ●○○○○ -0.81 | -0.8134202983275937 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.81 | 1.1e-6 | ○○○○○ 1.76 | 1.758559119318119 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)