Bacterial taxon 1392858
Locus CO715_08245
Protein ATI05704.1
dimethyl sulfoxide reductase subunit B
Escherichia coli M12
Length 205 aa, Gene n/a, UniProt n/a
>ATI05704.1|Escherichia coli M12|dimethyl sulfoxide reductase subunit B
MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETKGHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPNIVIKPNANSRPTGDTTGYLANPKEV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.45 | 1.0e-7 | ●●○○○ -1.43 | -1.425170412105255 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.56 | 2.0e-5 | ●●○○○ -1.03 | -1.0312467372034049 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)