Bacterial taxon 1392858
Locus CO715_16310
Protein ATI07139.1
division/cell wall cluster transcriptional repressor MraZ
Escherichia coli M12
Length 152 aa, Gene n/a, UniProt n/a
>ATI07139.1|Escherichia coli M12|division/cell wall cluster transcriptional repressor MraZ
MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.68 | 1.1e-22 | ●○○○○ -0.64 | -0.6381576463585503 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.1 | 0.0026 | ○○○○○ 0.98 | 0.9838564684120972 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)