Bacterial taxon 1392858
Locus CO715_13645
Protein ATI06657.1
DNA polymerase III subunit chi
Escherichia coli M12
Length 147 aa, Gene n/a, UniProt n/a
>ATI06657.1|Escherichia coli M12|DNA polymerase III subunit chi
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.74 | 0.00026 | ●○○○○ -0.23 | -0.23463625480125258 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.88 | 3.2e-14 | ○○○○○ 1.77 | 1.7721211102442953 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)