Bacterial taxon 1392858
Locus CO715_23265
Protein ATI08386.1
DNA repair protein RadC
Escherichia coli M12
Length 97 aa, Gene n/a, UniProt n/a
>ATI08386.1|Escherichia coli M12|DNA repair protein RadC
MQMNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKADRLITERLVQALGLVDIRVPDHLIVGGSQVFSFAEYGLL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.26 | 0.014 | ○○○○○ 0.07 | 0.07374255425856441 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.11 | 0.015 | ○○○○○ 0.99 | 0.9853169905118393 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)