Bacterial taxon 1392858
Locus CO715_07050
Protein ATI05493.1
DNA-binding protein
Escherichia coli M12
Length 75 aa, Gene n/a, UniProt n/a
>ATI05493.1|Escherichia coli M12|DNA-binding protein
MQNLDEPIKGVGIPEVAKACGVSERAVYKWLKNGFLPKTEFFGKTKYASKIEEISGGKYQASEMLEISKKNLLAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -13.25 | 1.7e-13 | ●●●○○ -2.22 | -2.219068496322172 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.28 | 2.0e-14 | ●●○○○ -1.39 | -1.3903265277256953 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)