Bacterial taxon 1392858
Locus CO715_10255
Protein ATI06047.1
DNA-binding protein
Escherichia coli M12
Length 83 aa, Gene n/a, UniProt n/a
>ATI06047.1|Escherichia coli M12|DNA-binding protein
MSEVIMIVSPGKWVSEEQLIALKGIKKGTLKKAREKSFMEGREYKHVAHDGMPWDNSPCFYNLEEIDRWIERQASARPRRHLT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.87 | 7.5e-10 | ●●○○○ -1.72 | -1.7212391063243893 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.64 | 8.6e-8 | ●○○○○ -0.84 | -0.8395010501087014 | 29101196 |
Retrieved 2 of 2 entries in 2.4 ms
(Link to these results)