Bacterial taxon 1392858
Locus CO715_06375
Protein ATI05377.1
DNA-binding protein H-NS
Escherichia coli M12
Length 137 aa, Gene n/a, UniProt n/a
>ATI05377.1|Escherichia coli M12|DNA-binding protein H-NS
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.6 | 6.9e-38 | ●○○○○ -0.41 | -0.4132372429982778 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.42 | 3.9e-5 | ○○○○○ 0.84 | 0.8432290548083645 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)