Bacterial taxon 1392858
Locus CO715_05190
Protein ATI05178.1
DNA-binding response regulator
Escherichia coli M12
Length 218 aa, Gene n/a, UniProt n/a
>ATI05178.1|Escherichia coli M12|DNA-binding response regulator
MINVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRANAVDVVLMDMSMPGIGGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDIAQQMALSQIEPEKTESPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNIHGDVELTHLAIRHGLCNAETLSSQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.61 | 6.1e-6 | ○○○○○ 1.72 | 1.716412624439849 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.72 | 9.1e-6 | ○○○○○ 1.74 | 1.7389463939787257 | 29101196 |
Retrieved 2 of 2 entries in 24.6 ms
(Link to these results)