Bacterial taxon 1392858
Locus CO715_07930
Protein ATI05645.1
DNA-binding response regulator
Escherichia coli M12
Length 210 aa, Gene n/a, UniProt n/a
>ATI05645.1|Escherichia coli M12|DNA-binding response regulator
MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTITVLSNREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.96 | 6.3e-20 | ●○○○○ -0.28 | -0.2799124398932555 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.75 | 6.0e-10 | ●○○○○ -0.03 | -0.028076700694879886 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)