Bacterial taxon 1392858
Locus CO715_08545
Protein ATI05758.1
DNA-binding transcriptional regulator
Escherichia coli M12
Length 178 aa, Gene n/a, UniProt n/a
>ATI05758.1|Escherichia coli M12|DNA-binding transcriptional regulator
MRRANDPQRREKIIQATLEAVKLYGIHAVTHRKIATLAGVPLGSMTYYFSGIDELLLEAFSSFTEIMSRQYQAFFSDVSDAQGACQAITDMIYSSQVATPDNMELMYQLYALASRKPLLKTVMQNWMQRSQQTLEQWFEPGTARALDAFIEGMTLHFVTDRKPLSREEILRMVERVAG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.38 | 4.5e-9 | ●○○○○ -0.99 | -0.9932731626101121 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.28 | 4.9e-9 | ●○○○○ -0.76 | -0.763553900922116 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)