Bacterial taxon 1392858   Locus CO715_08575   Protein ATI05764.1

DNA-binding transcriptional repressor DeoR

Escherichia coli M12

Length 252 aa, Gene n/a, UniProt n/a

>ATI05764.1|Escherichia coli M12|DNA-binding transcriptional repressor DeoR
METRREERIGQLLQELKRSDKLHLKDAAALLGVSEMTIRRDLNNHSAPVVLLGGYIVLEPRSASHYLLSDQKSRLVEEKRRAAKLAATLVEPDQTLFFDCGTTTPWIIEAIDNEIPFTAVCYSLNTFLALKEKPHCRAFLCGGEFHASNAIFKPIDFQQTLNNFCPDIAFYSAAGVHVSKGATCFNLEELPVKHWAMSMAQKHVLVVDHSKFGKVRPARMGDLKRFDIMVSDCCPEDEYVKYAQTQRIKLMY

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.032.5e-10●●○○○ -1.55-1.5470196844265929101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study0.280.74○○○○○ 0.60.604329368493418629101196
Retrieved 2 of 2 entries in 9.7 ms (Link to these results)