Bacterial taxon 1392858
Locus CO715_24180
Protein ATI08537.1
DNA-protecting protein DprA
Escherichia coli M12
Length 374 aa, Gene n/a, UniProt n/a
>ATI08537.1|Escherichia coli M12|DNA-protecting protein DprA
MVDTEIWLRLMSISSLYGDDMVRIAHWLAKQSYIDAVVLQQTGLTLRQAQRFLSFPRKSIESSLCWLEQPNHHLIPADSEFYPPQLLATTDYPGALFVEGELHALHSFQLAVVGSRAHSWYGERWGRLFCETLATRGVTITSGLARGIDGVAHKAALQVNGVSIAVLGNGLNTIHPRRHARLATSLLEHGGALVSEFPLDVPPLAYNFPRRNRIISGLSKGVLVVEAALRSGSLVTARCALEQGREVFALPGPLGNPGSEGPHWLIKQGAILVTEPEEILENLQFGLHWLPDAPENSFYSPDQEDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGWIAAVPGGYVRLRRACHVRRTNVFV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.27 | 9.3e-35 | ●○○○○ -0.76 | -0.7623020248366227 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.89 | 0.025 | ○○○○○ 0.73 | 0.7309774991424773 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)