Bacterial taxon 1392858
Locus CO715_22225
Protein ATI08209.1
dTDP-4-amino-4,6-dideoxygalactose transaminase
Escherichia coli M12
Length 376 aa, Gene n/a, UniProt n/a
>ATI08209.1|Escherichia coli M12|dTDP-4-amino-4,6-dideoxygalactose transaminase
MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFHYIPLHGCPAGERFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.89 | 1.5e-29 | ●○○○○ -0.89 | -0.8908279696139212 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.66 | 2.0e-5 | ●○○○○ -0.01 | -0.00950720542673124 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)