Bacterial taxon 1392858
Locus CO715_12255
Protein ATI06412.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Escherichia coli M12
Length 183 aa, Gene n/a, UniProt n/a
>ATI06412.1|Escherichia coli M12|dTDP-4-dehydrorhamnose 3,5-epimerase
MNVIKTAIPGVLIFEPKVFGDERGFFFESFNHKLFEEAVGYPVTFVQDNHSKSSKGVLRGLHYQLPPHAQGKLVRCVAGEVFDVAVDIRKSSPSFGQWVGVHLSGENKRQLWIPEGFAHGFVTLTESAEFLYKTTNYYAPASDRGIAWNDPTIGIRWPELKADILTSAKDSIAKSLESAELFI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.81 | 0.019 | ●○○○○ -0.04 | -0.040178169521313895 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.36 | 0.0026 | ○○○○○ 1.25 | 1.2467504463656625 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)