Bacterial taxon 1392858
Locus CO715_14965
Protein ATI06899.1
DUF1097 domain-containing protein
Escherichia coli M12
Length 165 aa, Gene n/a, UniProt n/a
>ATI06899.1|Escherichia coli M12|DUF1097 domain-containing protein
MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSFYAAGGGKSGFIRSLAVNYSGMVWAFFAALAAGWLASVSGLSTFWASVIMTVPFSAVVVWQGRFGLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKRDGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.75 | 0.00059 | ●○○○○ -0.24 | -0.23672271494374114 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4 | 0.00039 | ○○○○○ 1.38 | 1.3804925414991824 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)