Bacterial taxon 1392858
Locus CO715_08015
Protein ATI05661.1
DUF1116 domain-containing protein
Escherichia coli M12
Length 419 aa, Gene n/a, UniProt n/a
>ATI05661.1|Escherichia coli M12|DUF1116 domain-containing protein
MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHAGPPMCWQEMTGPMKGACVGACLFEGWAKDEAQALAMLDQGEVNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRTLAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAAMDAGAMIRSGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEMAEIFLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVRAPLACFEQALEALAESMGIG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.7 | 2.8e-9 | ●●○○○ -1.06 | -1.0612917632552408 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.13 | 0.0062 | ●○○○○ -0.11 | -0.10673624806670062 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)