Bacterial taxon 1392858
Locus CO715_15575
Protein ATI07006.1
DUF1287 domain-containing protein
Escherichia coli M12
Length 205 aa, Gene n/a, UniProt n/a
>ATI07006.1|Escherichia coli M12|DUF1287 domain-containing protein
MKASLALVSLLTAFTSNSLKSPAVPPTVVQIQANTNLAIADGARQQIGSTLFYDPAYVQLTYPGGDVPQERGVCSDVVIRALRSQKVDLQKLVHEDMAKNFAEYPQKWQLKRPDSNIDHRRVPNLETWFSRHDKTRPTSKNPSDYQAGDIVSWRLDNGLAHIGVVSDGFARDGTPLVIHNIGAGAQEEDVLFSWRMVGHYRYFVK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.49 | 1.9e-11 | ●●○○○ -1.64 | -1.6425795589525685 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.94 | 9.3e-16 | ●●○○○ -1.53 | -1.5267810210444503 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)