Bacterial taxon 1392858
Locus CO715_15435
Protein ATI06983.1
DUF1454 domain-containing protein
Escherichia coli M12
Length 199 aa, Gene n/a, UniProt n/a
>ATI06983.1|Escherichia coli M12|DUF1454 domain-containing protein
MKPGCTLFFLLCSALTVTTTAHAQTPDTATTAPYLLAGAPTFDLSISQFREDFNSQNPSLPLNEFRAIDSSPDKANLTRAASKINENLYASTALERGTLKIKSIQMTWLPIQGPEQKAAKAKAQEYMAAVIRTLTPLMTKTQSQKKLQSLLTAGKNKRYYTETEGALRYVVADNGEKGLTFAVEPIKLALSESLEGLNK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.15 | 2.7e-5 | ●○○○○ -0.74 | -0.7378904411695059 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.98 | 1.9e-5 | ○○○○○ 1.38 | 1.376736913242703 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)