Bacterial taxon 1392858
Locus CO715_04335
Protein ATI08722.1
DUF1481 domain-containing protein
Escherichia coli M12
Length 231 aa, Gene n/a, UniProt n/a
>ATI08722.1|Escherichia coli M12|DUF1481 domain-containing protein
MNSFNEGVVSPLLSFWRRSLMLAGALFLTACSHNSSLPPFTASGFAEDQGAVRIWRKDSGDNVHLLAVFSPWRSGDTTTREYRWQGDNLTLININVYSKPPVNIRARFDDRGDLSFMQRESDGEKQQLSNDQIDLYRYRADQIRQISDALRQGRVVLRQGRWHAMEQTVTTCEGQTIKPDLDSQAIAHIERRQSRSSVDVSVAWLEAPEGSQLLLVANSDFCRWQPNEKTF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.39 | 3.1e-77 | ●○○○○ -0.37 | -0.3700475180487635 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.62 | 4.6e-29 | ○○○○○ 1.09 | 1.0923523958215051 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)