Bacterial taxon 1392858
Locus CO715_10245
Protein ATI06045.1
DUF1482 domain-containing protein
Escherichia coli M12
Length 63 aa, Gene n/a, UniProt n/a
>ATI06045.1|Escherichia coli M12|DUF1482 domain-containing protein
MNTAFALVLTVFLVSGEPVDIAVSVHRTMQECVTAATEQKIPGNCYPVDKVIHQDNNEIPAGL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.96 | 7.2e-29 | ●●○○○ -1.53 | -1.532205817414921 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.83 | 6.9e-16 | ●○○○○ -0.46 | -0.4614344722897647 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)