Bacterial taxon 1392858
Locus CO715_10875
Protein ATI06155.1
DUF1870 domain-containing protein
Escherichia coli M12
Length 118 aa, Gene n/a, UniProt n/a
>ATI06155.1|Escherichia coli M12|DUF1870 domain-containing protein
MNAYELQALRHIFAMTIDECATWIAQTGDSESWRQWENGKYAIPDRVVEQLLAMRQQRKKHLHAIIEKINNRIGNNTMRFFPDLTAFQQVYPDGNFIDWKIYQSVAAELYAHDLERLC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.51 | 2.6e-62 | ●○○○○ -0.19 | -0.18560444145277022 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.64 | 1.3e-15 | ○○○○○ 0.89 | 0.8891311779431141 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)