Bacterial taxon 1392858
Locus CO715_11515
Protein ATI06278.1
DUF1889 domain-containing protein
Escherichia coli M12
Length 119 aa, Gene n/a, UniProt n/a
>ATI06278.1|Escherichia coli M12|DUF1889 domain-containing protein
MQIKVIYSLIDNMVNFKDKNMPAVIDKALDFIGAMDVSAPTPSSMNESTAKGIFKYLKELGVPASAADITARADQEGWNPGFTEKMVGWAKKMESGERIVIKNPEYFSTYMQEELKALV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.29 | 2.2e-12 | ●●○○○ -1.18 | -1.1825150975338292 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.54 | 5.5e-5 | ○○○○○ 1.08 | 1.0754520686673472 | 29101196 |
Retrieved 2 of 2 entries in 2.5 ms
(Link to these results)