Bacterial taxon 1392858
Locus CO715_04820
Protein ATI05113.1
DUF2135 domain-containing protein
Escherichia coli M12
Length 258 aa, Gene n/a, UniProt n/a
>ATI05113.1|Escherichia coli M12|DUF2135 domain-containing protein
MRKIFLPLLLVALSPVAHSEGVQEVEIDAPLSGWHPAEGEDASFSQSINYPASSVNMADDQNISAQIRGKIKNYAAVGKVQQGRLVVNGASMPQRIESDGSFARPYIFTEGSNSVQVISPDGQSRQKMQFYSTPGAGVIRARLRLVLSWDTDNTDLDLHVVTPDGEHAWYGNTVLKNSGALDMDVTTGYGPEIFAMPAPIHGRYQVYINYYGGRSETELTTAQLTLITDEGSVNEKQETFIVPMRNAGELTLVKSFDW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.81 | 1.3e-6 | ○○○○○ 0.17 | 0.16805055269904964 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.97 | 4.1e-17 | ○○○○○ 1.16 | 1.16475256276586 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)