Bacterial taxon 1392858
Locus CO715_19420
Protein ATI07696.1
DUF2543 domain-containing protein
Escherichia coli M12
Length 81 aa, Gene n/a, UniProt n/a
>ATI07696.1|Escherichia coli M12|DUF2543 domain-containing protein
MNHDIPLKYFDIADEYATECAEPVADAERTPLAHYFQLLLTRLMNNEEISEEAQHEMAAEAGISPVRIDEIAEFLNQWGNE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.02 | 3.9e-16 | ●○○○○ -0.92 | -0.9187865355232686 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.9 | 0.035 | ○○○○○ 0.73 | 0.7334812513134636 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)