Bacterial taxon 1392858
Locus CO715_10535
Protein ATI06096.1
DUF2569 domain-containing protein
Escherichia coli M12
Length 146 aa, Gene n/a, UniProt n/a
>ATI06096.1|Escherichia coli M12|DUF2569 domain-containing protein
MTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGEQALTTQILWGVSFITAIAMWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVEDGIAVRQLLFTLLATALIVPYFKRSSRVKATFVNP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.28 | 7.1e-13 | ●○○○○ -0.56 | -0.5561597627587479 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.73 | 6.3e-5 | ●○○○○ -0.02 | -0.024321072438400426 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)