Bacterial taxon 1392858
Locus CO715_14585
Protein ATI06830.1
DUF3261 domain-containing protein
Escherichia coli M12
Length 194 aa, Gene n/a, UniProt n/a
>ATI06830.1|Escherichia coli M12|DUF3261 domain-containing protein
MIKPTFWRAFALTATLILTGCSHSQPEQEGRPQAWLQPGTRITLPAPGISPAVNSQQLLSGSFNGKTQSLLVMLNADDQKITLAGLSSVGIRLFLVTYDAQGLRAEQSIVVPQLPPASQVLADVMLSHWPISAWQPQLPAGWTLRDNGDKRELRNASGKLVTEITYLNRQGKRVPISIEQHVFKYHITIQYLGD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.84 | 5.1e-10 | ●●○○○ -1.71 | -1.7147710798826743 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.62 | 0.00014 | ●○○○○ -0.83 | -0.8347021917809776 | 29101196 |
Retrieved 2 of 2 entries in 148.3 ms
(Link to these results)