Bacterial taxon 1392858
Locus CO715_22955
Protein ATI08333.1
DUF3343 domain-containing protein
Escherichia coli M12
Length 85 aa, Gene n/a, UniProt n/a
>ATI08333.1|Escherichia coli M12|DUF3343 domain-containing protein
MKEYLFLFHSTVGVIQTRKALQAAGMTFRVSDIPRDLRGGCGLCIWLTCPPGEEIQWVIPGHTESVYCQQDGGWRCIAHYGISPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.84 | 2.1e-117 | ●○○○○ -0.46 | -0.4628949943895069 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.7 | 1.1e-42 | ○○○○○ 1.11 | 1.110087307032658 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)