Bacterial taxon 1392858
Locus CO715_11400
Protein ATI06257.1
DUF441 family protein
Escherichia coli M12
Length 148 aa, Gene n/a, UniProt n/a
>ATI06257.1|Escherichia coli M12|DUF441 family protein
MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIVGKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.52 | 4.5e-9 | ●●○○○ -1.44 | -1.4410275091881681 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.74 | 3.5e-6 | ●○○○○ -0.23 | -0.23338437871575946 | 29101196 |
Retrieved 2 of 2 entries in 16.8 ms
(Link to these results)