Bacterial taxon 1392858
Locus CO715_11045
Protein ATI06189.1
DUF481 domain-containing protein
Escherichia coli M12
Length 252 aa, Gene n/a, UniProt n/a
>ATI06189.1|Escherichia coli M12|DUF481 domain-containing protein
MKLLKTVPAIVMLAGGMFASLNAAADDSVFTVMDDPASAKKPFEGNLNAGYLAQSGNTKSSSLTADTTMTWYGQTTAWSLWGNASNTSSNDERSSEKYAAGGRSRFNLTDYDYLFGQASWLTDRYNGYRERDVLTAGYGRQFLNGPVHSFRFEFGPGVRYDKYTDNASETQPLGYASGAYAWQLTDNAKFTQGVSVFGAEDTTLNSESALNVAINEHFGLKVAYNVTWNSEPPESAPEHTDRRTTLSLGYSM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.41 | 2.5e-7 | ●○○○○ -0.37 | -0.3746377303622385 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.02 | 0.00022 | ○○○○○ 1.18 | 1.1758108015210496 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)