Bacterial taxon 1392858
Locus CO715_15440
Protein ATI06984.1
DUF805 domain-containing protein
Escherichia coli M12
Length 146 aa, Gene n/a, UniProt n/a
>ATI06984.1|Escherichia coli M12|DUF805 domain-containing protein
MTIQQWLFSFKGRIGRRDFWIWIGLWFAGMLVLFSLAGKNLLDIQTAAFCLVCLLWPTAAVTVKRLHDRGRSGAWAFLMIVAWMLLAGNWAILPGVWQWAVGRFVPTLILVMMLIDLGAFVGTQGENKYGKDTEDVKYKADNKSSN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.26 | 0.00085 | ●●○○○ -1.18 | -1.1772989471776076 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.07 | 0.02 | ●○○○○ -0.51 | -0.5119268077379892 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)