Bacterial taxon 1392858
Locus CO715_10975
Protein ATI06175.1
EAL domain-containing protein
Escherichia coli M12
Length 237 aa, Gene n/a, UniProt n/a
>ATI06175.1|Escherichia coli M12|EAL domain-containing protein
MKIFLENLYHSDCYFLPIRDNQQDLVGVELITHFSSEDGTVRIPTSRVIAQLTAEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLDRDNYAGELLKYPFIELLINENYPHLDEGKDNRDLLSLSQMYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTPEIMAQITPFDFHALQGCLWPAVPINQITTLVQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.83 | 2.8e-29 | ●○○○○ -0.46 | -0.4614344722897647 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.41 | 3.4e-9 | ○○○○○ 1.05 | 1.0493713168862395 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)