Bacterial taxon 1392858
Locus CO715_12945
Protein ATI06534.1
EamA family transporter
Escherichia coli M12
Length 321 aa, Gene n/a, UniProt n/a
>ATI06534.1|Escherichia coli M12|EamA family transporter
MKQQAGIGILLALTTAICWGALPIAMKQVLEVMEPPTIVFYRFLMASIGLGAILAVKKRLPPLRVFRKPRWLILLAVATAGLFGNFILFSSSLQYLSPTASQVIGQLSPVGMMVASVFILKEKMRSTQVVGALMLLSGLVMFFNTSLVEIFTKLTDYTWGVIFGVGAATVWVSYGVAQKVLLRRLASPQILFLLYTLCTIALFPLAKPGVIAQLSHWQLACLIFCGLNTLVGYGALAEAMARWQAAQVSAIITLTPLFTLFFSDLLSLAWPDFFARPMLNLLGYLGAFVVVAGAMYSAIGHRIWGGLRKHTTVVSQPRAGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.78 | 1.3e-9 | ●●○○○ -1.29 | -1.2853775825585179 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.32 | 0.017 | ○○○○○ 0.06 | 0.062058377460628165 | 29101196 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)