Bacterial taxon 1392858
Locus CO715_15865
Protein ATI07055.1
EamA family transporter
Escherichia coli M12
Length 299 aa, Gene n/a, UniProt n/a
>ATI07055.1|Escherichia coli M12|EamA family transporter
MALLIITTILWAFSFSFYGEYLAGHVDSYFAVLVRVGLAALVFLPFLRTRGNSLKTVGLYMLVGAMQLGVMYMLSFRAYLYLTVSELLLFTVLTPLYITLIYDIMSQRRLRWGYAFSALLAVIGAGIIRYDQVTDHFWTGLLLVQLSNITFAIGMVGYKRLMETRPMPQHNAFAWFYLGAFLVAVIAWFLLGNAQKMPQTTLQWGILVFLGVVASGIGYFMWNYGATQVDAGTLGIMNNMHVPAGLLVNLAIWHQQPHWPTFITGALVILASLWVHRKWVAPRSSQTADDRRRDCALSE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.22 | 5.1e-5 | ●○○○○ -0.75 | -0.7516610781099308 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.91 | 0.0077 | ●○○○○ -0.27 | -0.2690628471523147 | 29101196 |
Retrieved 2 of 2 entries in 2.3 ms
(Link to these results)