Bacterial taxon 1392858
Locus CO715_15570
Protein ATI07005.1
EamA/RhaT family transporter
Escherichia coli M12
Length 301 aa, Gene n/a, UniProt n/a
>ATI07005.1|Escherichia coli M12|EamA/RhaT family transporter
MSAAGKSNPLAISGLVVLTLIWSYSWIFMKQVTSYIGAFDFTALRCIFGALVLFIVLLLRGRGMRPTPFKYTLAIALLQTCGMVGLAQWALVSGGAGKVAILSYTMPFWVVIFAALFLGERLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSALLAILSGVSWGASAIVAKRLYARHPRVDLLSLTSWQMLYAALVMSAVALLVPQREIDWQPTVFWALAYSAILATALAWSLWLFVLKNLPASIASLSTLAVPVCGVLFSWWLLGENPGAVEGSGIVLIVLALALVSRKKKEAVSVKNI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.17 | 8.4e-8 | ○○○○○ 1 | 0.9997135654950106 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.07 | 1.9e-96 | ○○○○○ 1.4 | 1.396140992567847 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)