Bacterial taxon 1392858
Locus CO715_10540
Protein ATI06097.1
electron transport complex subunit A
Escherichia coli M12
Length 193 aa, Gene n/a, UniProt n/a
>ATI06097.1|Escherichia coli M12|electron transport complex subunit A
MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.29 | 1.3e-37 | ●●○○○ -1.39 | -1.3922043418539347 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.94 | 2.0e-44 | ●●○○○ -1.11 | -1.1113668066749676 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)