Bacterial taxon 1392858
Locus CO715_21385
Protein ATI08054.1
elongation factor P-like protein YeiP
Escherichia coli M12
Length 190 aa, Gene n/a, UniProt n/a
>ATI08054.1|Escherichia coli M12|elongation factor P-like protein YeiP
MPRANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDDIVDTVTLTRRYVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTWDGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHIEERRYMGRAD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.18 | 1.0e-60 | ●●○○○ -1.16 | -1.1608159120519475 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.94 | 0.0034 | ○○○○○ 0.35 | 0.35103310719530095 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)