Bacterial taxon 1392858
Locus CO715_01480
Protein ATI04518.1
entericidin B
Escherichia coli M12
Length 48 aa, Gene n/a, UniProt n/a
>ATI04518.1|Escherichia coli M12|entericidin B
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.17 | 3.1e-17 | ●○○○○ -0.74 | -0.7412287773974877 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.73 | 0.0014 | ●○○○○ -0.65 | -0.6502591151849842 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)