Bacterial taxon 1392858   Locus CO715_01270   Protein ATI04482.1

esterase

Escherichia coli M12

Length 249 aa, Gene n/a, UniProt n/a

>ATI04482.1|Escherichia coli M12|esterase
MIEIESRELADIPVLHAYPVGQKDTPLPCAIFYHGFTSSSLVYSYFAVALAQAGLRVIMPDAPDHGSRFSGDAARRLNQFWQILLQSMQEFTTLRAAIAEENWLRDDRLAVGGASMGAMTALGITARHPTVKCTASMMGSGYFTSLARSLFPPLIPETAAQQNEFNNIVAPLAEWEATNHLEQLGDRPLLLWHGLDDDVVPADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDAAVTFFRQHL
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study6.068.1e-22○○○○○ 1.811.810720622880334329101196
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-1.010.1○○○○○ 0.330.3349673640981386529101196
Retrieved 2 of 2 entries in 2.4 ms (Link to these results)