Bacterial taxon 1392858
Locus CO715_02830
Protein ATI04765.1
ethanolamine utilization protein EutS
Escherichia coli M12
Length 111 aa, Gene n/a, UniProt n/a
>ATI04765.1|Escherichia coli M12|ethanolamine utilization protein EutS
MDKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPDAGAIGIMTLTPGETAMIAGDLALKAADVHIGFLDRFSGALVIYGSVGAVEEALSQTVSGLGRLLNYTLCEMTKC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.49 | 5.9e-15 | ●●○○○ -1.22 | -1.2242443003836014 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.25 | 6.5e-14 | ●○○○○ -0.97 | -0.9657318887292625 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)