Bacterial taxon 1392858
Locus CO715_16505
Protein ATI07175.1
ferredoxin-like protein FixX
Escherichia coli M12
Length 95 aa, Gene n/a, UniProt n/a
>ATI07175.1|Escherichia coli M12|ferredoxin-like protein FixX
MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPAGLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.94 | 3.1e-5 | ●○○○○ -0.9 | -0.9008429782978665 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.56 | 0.0029 | ●○○○○ -0.4 | -0.4042654643855767 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)