Bacterial taxon 1392858
Locus CO715_03875
Protein ATI04954.1
ferrous iron transporter A
Escherichia coli M12
Length 75 aa, Gene n/a, UniProt n/a
>ATI04954.1|Escherichia coli M12|ferrous iron transporter A
MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVLRKKDLALLEVEAVSC
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.19 | 4.8e-52 | ●○○○○ -0.75 | -0.745401697682465 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.32 | 1.0e-15 | ●○○○○ -0.15 | -0.14637899077398425 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)