Bacterial taxon 1392858
Locus CO715_03375
Protein ATI04860.1
fimbrial protein
Escherichia coli M12
Length 188 aa, Gene n/a, UniProt n/a
>ATI04860.1|Escherichia coli M12|fimbrial protein
MSKFVKAAVATAMLMGALTSASVVAAGNNGTVRFYGTIEDSPCSIVPDDHKLEVDMGSIGTGSLTGGKTTTPKDFQIRLQDCNFNTETTMATTFTGNPYSTNADNYSLSNMDNGTEIPNVSLVIGDQHGTGYALGAEIKQPIVKDSSTGKGKPKQTLNFKAWLVGETDAVTPTPAPFETLTTFQITYL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.03 | 4.8e-60 | ○○○○○ 0.12 | 0.12214842956430016 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.93 | 5.8e-58 | ○○○○○ 0.95 | 0.9492212300467863 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)