Bacterial taxon 1392858
Locus CO715_06240
Protein ATI05354.1
fimbrial protein
Escherichia coli M12
Length 167 aa, Gene n/a, UniProt n/a
>ATI05354.1|Escherichia coli M12|fimbrial protein
MKRLHKRFLLATFCALFTATLQAADVTITVNGRVVAKPCTIQTKEANVNLGDLYTRNLQQPGSASGWHNITLSLTDCPVETSAVTAIVTGSTDNTGYYKNEGTAENIQIELRDDQDATLKNGDSKTVIVDEITRNAQFPLKARAITVNGNASQGTIEALINVIYTWQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.55 | 3.8e-20 | ●●○○○ -1.03 | -1.0289516310466675 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.08 | 0.0028 | ○○○○○ 0.11 | 0.11129883682335938 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)