Bacterial taxon 1392858
Locus CO715_16010
Protein ATI07082.1
fimbrial protein
Escherichia coli M12
Length 186 aa, Gene n/a, UniProt n/a
>ATI07082.1|Escherichia coli M12|fimbrial protein
MIKNTRYKIVLLAGIFLLPGALAQDINVDFVATIKGTTCNITLEGTRVTADGNNQYTLRILNVALDKIINKMPEAQADFKLVANCDGNIGKITTSLAGNPSVELPYLISPLTSDNSSTTEYIAMGIKLRNASDTEFIPPDGSKKISWGEGLTKPELEMTVALRETRPGSGRAGNFKALATFNFTYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.83 | 4.2e-26 | ○○○○○ 0.17 | 0.1651295084995656 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.88 | 2.2e-7 | ○○○○○ 0.36 | 0.36355186805023265 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)