Bacterial taxon 1392858
Locus CO715_16630
Protein ATI07199.1
fimbrial protein
Escherichia coli M12
Length 177 aa, Gene n/a, UniProt n/a
>ATI07199.1|Escherichia coli M12|fimbrial protein
MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNGDSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANNFTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLSAQYARTSGNPVTKGSVESTVTIKISAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.18 | 1.1e-9 | ○○○○○ 0.3 | 0.30054077174707655 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.64 | 2.1e-7 | ○○○○○ 0.68 | 0.680276517680004 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)