Bacterial taxon 1392858
Locus CO715_04740
Protein ATI05104.1
flagellar assembly protein FliH
Escherichia coli M12
Length 228 aa, Gene n/a, UniProt n/a
>ATI05104.1|Escherichia coli M12|flagellar assembly protein FliH
MSDNLPWKTWTPDDLAPPQAEFVPMVEPEETIIEEAEPSLEQQLAQLQMQAHEQGYQAGIAEGRQQGHEQGYQEGLAQGLEQGLAEAKSQQAPIHARMQQLVSEFQTTLDALDSVIASRLMQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLGATLSLHGWRLRGDPTLHPGGCKVSADEGDLDASVATRWQELCRLAAPGVV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.39 | 3.3e-18 | ●○○○○ -0.79 | -0.7867136085037394 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.73 | 8.5e-29 | ○○○○○ 1.53 | 1.5321781938581045 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)