Bacterial taxon 1392858
Locus CO715_20875
Protein ATI07962.1
flagellar biosynthesis protein FlgF
Escherichia coli M12
Length 251 aa, Gene n/a, UniProt n/a
>ATI07962.1|Escherichia coli M12|flagellar biosynthesis protein FlgF
MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVEGLSLPTRTLVTASTPGADMTPGKMDYTSRPLDVALQQDGWLAVQTADGSEGYTRNGSIQVDPTGQLTIQGHPVIGEAGPIAVPEGAEITIAADGTISALNPGDPANTVAPVGRLKLVKATGSEVQRGDDGIFRLSAESQATRGPVLQADPTLRVMSGVLEGSNVNAVAAMSDMIASARRFEMQMKVISSVDDNAGRANQLLSMS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.02 | 5.7e-125 | ●●○○○ -1.13 | -1.1263893197008856 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2 | 2.2e-26 | ○○○○○ 0.96 | 0.9627832209729622 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)