Bacterial taxon 1392858
Locus CO715_04755
Protein ATI08727.1
flagellar hook-basal body complex protein FliE
Escherichia coli M12
Length 104 aa, Gene n/a, UniProt n/a
>ATI08727.1|Escherichia coli M12|flagellar hook-basal body complex protein FliE
MSAIQGIEGVISQLQTTAMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFTLGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.22 | 5.7e-54 | ●●○○○ -1.59 | -1.5852019050341315 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.75 | 8.1e-60 | ●●○○○ -1.28 | -1.2797441401737986 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)