Bacterial taxon 1392858
Locus CO715_05125
Protein ATI05166.1
flagellar protein FliT
Escherichia coli M12
Length 121 aa, Gene n/a, UniProt n/a
>ATI05166.1|Escherichia coli M12|flagellar protein FliT
MNNAPHLYFAWQQLVEKSQLMLRLATEEQWDELIASEMAYVNAVQEIAHLTEEVEPSTTMQEQLRPMLHLILDNESKVKQLLQIRMDELAKLVGQSSVQKSVLSAYGDQGGFVLAPQDNLF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.37 | 0.0017 | ●●○○○ -1.62 | -1.617333391228456 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.37 | 0.0028 | ●●○○○ -1.41 | -1.40952196103659 | 29101196 |
Retrieved 2 of 2 entries in 15.5 ms
(Link to these results)